Anti SWT1 pAb (ATL-HPA027334)

Atlas Antibodies

Catalog No.:
ATL-HPA027334-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: SWT1 RNA endoribonuclease homolog (S. cerevisiae)
Gene Name: SWT1
Alternative Gene Name: C1orf26, FLJ20121, HsSwt1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052748: 88%, ENSRNOG00000032258: 89%
Entrez Gene ID: 54823
Uniprot ID: Q5T5J6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALTTSNIASFEEAFICLQKLMAAVRDILEGIQRILAPNSDYQDVETLYNFLIKYEVNKNVKFTAQEIYDCVSQTEYREKLTIGC
Gene Sequence ALTTSNIASFEEAFICLQKLMAAVRDILEGIQRILAPNSDYQDVETLYNFLIKYEVNKNVKFTAQEIYDCVSQTEYREKLTIGC
Gene ID - Mouse ENSMUSG00000052748
Gene ID - Rat ENSRNOG00000032258
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SWT1 pAb (ATL-HPA027334)
Datasheet Anti SWT1 pAb (ATL-HPA027334) Datasheet (External Link)
Vendor Page Anti SWT1 pAb (ATL-HPA027334) at Atlas Antibodies

Documents & Links for Anti SWT1 pAb (ATL-HPA027334)
Datasheet Anti SWT1 pAb (ATL-HPA027334) Datasheet (External Link)
Vendor Page Anti SWT1 pAb (ATL-HPA027334)