Anti SWSAP1 pAb (ATL-HPA052712)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052712-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SWSAP1
Alternative Gene Name: C19orf39, FLJ35119, SWS1AP1, ZSWIM7AP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051238: 73%, ENSRNOG00000012604: 74%
Entrez Gene ID: 126074
Uniprot ID: Q6NVH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EGQGPVLFLTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLD |
| Gene Sequence | EGQGPVLFLTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLD |
| Gene ID - Mouse | ENSMUSG00000051238 |
| Gene ID - Rat | ENSRNOG00000012604 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SWSAP1 pAb (ATL-HPA052712) | |
| Datasheet | Anti SWSAP1 pAb (ATL-HPA052712) Datasheet (External Link) |
| Vendor Page | Anti SWSAP1 pAb (ATL-HPA052712) at Atlas Antibodies |
| Documents & Links for Anti SWSAP1 pAb (ATL-HPA052712) | |
| Datasheet | Anti SWSAP1 pAb (ATL-HPA052712) Datasheet (External Link) |
| Vendor Page | Anti SWSAP1 pAb (ATL-HPA052712) |