Anti SWSAP1 pAb (ATL-HPA052712)

Atlas Antibodies

Catalog No.: ATL-HPA052712-25

Protein Description: SWIM-type zinc finger 7 associated protein 1
Gene Name: SWSAP1
Alternative Gene Name: C19orf39, FLJ35119, SWS1AP1, ZSWIM7AP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051238: 73%, ENSRNOG00000012604: 74%
Entrez Gene ID: 126074
Uniprot ID: Q6NVH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGQGPVLFLTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLD
• Gene Sequence: EGQGPVLFLTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLD
• Gene ID - Mouse: ENSMUSG00000051238
• Gene ID - Rat: ENSRNOG00000012604
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.