Anti SWSAP1 pAb (ATL-HPA052712)

Atlas Antibodies

Catalog No.:
ATL-HPA052712-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: SWIM-type zinc finger 7 associated protein 1
Gene Name: SWSAP1
Alternative Gene Name: C19orf39, FLJ35119, SWS1AP1, ZSWIM7AP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051238: 73%, ENSRNOG00000012604: 74%
Entrez Gene ID: 126074
Uniprot ID: Q6NVH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGQGPVLFLTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLD
Gene Sequence EGQGPVLFLTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPAPSLLLLDGLEEYLAEDPEPQEAAYLIALLLD
Gene ID - Mouse ENSMUSG00000051238
Gene ID - Rat ENSRNOG00000012604
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SWSAP1 pAb (ATL-HPA052712)
Datasheet Anti SWSAP1 pAb (ATL-HPA052712) Datasheet (External Link)
Vendor Page Anti SWSAP1 pAb (ATL-HPA052712) at Atlas Antibodies

Documents & Links for Anti SWSAP1 pAb (ATL-HPA052712)
Datasheet Anti SWSAP1 pAb (ATL-HPA052712) Datasheet (External Link)
Vendor Page Anti SWSAP1 pAb (ATL-HPA052712)