Anti SWI5 pAb (ATL-HPA052032)

Atlas Antibodies

Catalog No.:
ATL-HPA052032-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: SWI5 recombination repair homolog (yeast)
Gene Name: SWI5
Alternative Gene Name: bA395P17.9, C9orf119
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044627: 76%, ENSRNOG00000022860: 78%
Entrez Gene ID: 375757
Uniprot ID: Q1ZZU3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HLDIQKLKEKRDMLDKEISQFVSEGYSVDELEDHITQLHEYNDIKDVGQMLMGKLAVIRGVTTKELYPEFGL
Gene Sequence HLDIQKLKEKRDMLDKEISQFVSEGYSVDELEDHITQLHEYNDIKDVGQMLMGKLAVIRGVTTKELYPEFGL
Gene ID - Mouse ENSMUSG00000044627
Gene ID - Rat ENSRNOG00000022860
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SWI5 pAb (ATL-HPA052032)
Datasheet Anti SWI5 pAb (ATL-HPA052032) Datasheet (External Link)
Vendor Page Anti SWI5 pAb (ATL-HPA052032) at Atlas Antibodies

Documents & Links for Anti SWI5 pAb (ATL-HPA052032)
Datasheet Anti SWI5 pAb (ATL-HPA052032) Datasheet (External Link)
Vendor Page Anti SWI5 pAb (ATL-HPA052032)