Anti SWAP70 pAb (ATL-HPA006810 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA006810-25

Protein Description: SWAP switching B-cell complex 70kDa subunit
Gene Name: SWAP70
Alternative Gene Name: KIAA0640, SWAP-70
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031015: 98%, ENSRNOG00000009910: 98%
Entrez Gene ID: 23075
Uniprot ID: Q9UH65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLEEAASRAAEEEKKRLQTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQAR
• Gene Sequence: KLEEAASRAAEEEKKRLQTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQAR
• Gene ID - Mouse: ENSMUSG00000031015
• Gene ID - Rat: ENSRNOG00000009910
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.