Anti SVOP pAb (ATL-HPA016573)

Atlas Antibodies

Catalog No.: ATL-HPA016573-25

Protein Description: SV2 related protein homolog (rat)
Gene Name: SVOP
Alternative Gene Name: DKFZp761H039
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042078: 85%, ENSRNOG00000000693: 85%
Entrez Gene ID: 55530
Uniprot ID: Q8N4V2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPIETKGRGLQESSHREWGQEMVGRGMHGAGVTRSNSGSQE
• Gene Sequence: LPIETKGRGLQESSHREWGQEMVGRGMHGAGVTRSNSGSQE
• Gene ID - Mouse: ENSMUSG00000042078
• Gene ID - Rat: ENSRNOG00000000693
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SVOP pAb (ATL-HPA016573) – 1 Found

Wang, Hsien-Yi; Lin, Ching-Yih; Chien, Chih-Chiang; Kan, Wei-Chih; Tian, Yu-Feng; Liao, Pao-Chi; Wu, Hsin-Yi; Su, Shih-Bin. Impact of uremic environment on peritoneum: a proteomic view. Journal Of Proteomics. 2012;75(7):2053-63.