Anti SUZ12 pAb (ATL-HPA057436)

Atlas Antibodies

Catalog No.:
ATL-HPA057436-25
Immunohistochemical staining of human tonsil shows weak nuclear positivity in germinal center cells.
Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoli & nuclear bodies.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: SUZ12 polycomb repressive complex 2 subunit
Gene Name: SUZ12
Alternative Gene Name: CHET9, JJAZ1, KIAA0160
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017548: 96%, ENSRNOG00000058663: 90%
Entrez Gene ID: 23512
Uniprot ID: Q15022
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPIT
Gene Sequence NKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPIT
Gene ID - Mouse ENSMUSG00000017548
Gene ID - Rat ENSRNOG00000058663
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SUZ12 pAb (ATL-HPA057436)
Datasheet Anti SUZ12 pAb (ATL-HPA057436) Datasheet (External Link)
Vendor Page Anti SUZ12 pAb (ATL-HPA057436) at Atlas Antibodies

Documents & Links for Anti SUZ12 pAb (ATL-HPA057436)
Datasheet Anti SUZ12 pAb (ATL-HPA057436) Datasheet (External Link)
Vendor Page Anti SUZ12 pAb (ATL-HPA057436)
Citations for Anti SUZ12 pAb (ATL-HPA057436) – 1 Found
Bremer, Sebastian C B; Bittner, Gabi; Elakad, Omar; Dinter, Helen; Gaedcke, Jochen; König, Alexander O; Amanzada, Ahmad; Ellenrieder, Volker; Freiherr von Hammerstein-Equord, Alexander; Ströbel, Philipp; Bohnenberger, Hanibal. Enhancer of Zeste Homolog 2 (EZH2) Is a Marker of High-Grade Neuroendocrine Neoplasia in Gastroenteropancreatic and Pulmonary Tract and Predicts Poor Prognosis. Cancers. 2022;14(12)  PubMed
!