Anti SUSD2 pAb (ATL-HPA004117 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA004117-25

Protein Description: sushi domain containing 2
Gene Name: SUSD2
Alternative Gene Name: BK65A6.2, FLJ22778
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006342: 70%, ENSRNOG00000033389: 71%
Entrez Gene ID: 56241
Uniprot ID: Q9UGT4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDLKGMFLSVAAGDRVSIMLASGAGLEVSVQGPFLSVSVLLPEKFLTHTHGLLGTLNNDPTDDFTLHSGRVLPPGTSPQELFLFGANWTVHNASSLLTYDSWFLVHNFLYQPKHDPTFEPLFPSETTLNPSLAQEAAKLCGDDHFCNF
• Gene Sequence: MDLKGMFLSVAAGDRVSIMLASGAGLEVSVQGPFLSVSVLLPEKFLTHTHGLLGTLNNDPTDDFTLHSGRVLPPGTSPQELFLFGANWTVHNASSLLTYDSWFLVHNFLYQPKHDPTFEPLFPSETTLNPSLAQEAAKLCGDDHFCNF
• Gene ID - Mouse: ENSMUSG00000006342
• Gene ID - Rat: ENSRNOG00000033389
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SUSD2 pAb (ATL-HPA004117 w/enhanced validation) – 7 Found

Tang, Jessica; Pulliam, Nicholas; Özeş, Ali; Buechlein, Aaron; Ding, Ning; Keer, Harold; Rusch, Doug; O'Hagan, Heather; Stack, M Sharon; Nephew, Kenneth P. Epigenetic Targeting of Adipocytes Inhibits High-Grade Serous Ovarian Cancer Cell Migration and Invasion. Molecular Cancer Research : Mcr. 2018;16(8):1226-1240. 

Lindgren, David; Boström, Anna-Karin; Nilsson, Kristina; Hansson, Jennifer; Sjölund, Jonas; Möller, Christina; Jirström, Karin; Nilsson, Elise; Landberg, Göran; Axelson, Håkan; Johansson, Martin E. Isolation and characterization of progenitor-like cells from human renal proximal tubules. The American Journal Of Pathology. 2011;178(2):828-37. 

Pan, Wen; Cheng, Yingying; Zhang, Heyu; Liu, Baocai; Mo, Xiaoning; Li, Ting; Li, Lin; Cheng, Xiaojing; Zhang, Lianhai; Ji, Jiafu; Wang, Pingzhang; Han, Wenling. CSBF/C10orf99, a novel potential cytokine, inhibits colon cancer cell growth through inducing G1 arrest. Scientific Reports. 2014;4( 25351403):6812. 

Sheets, J N; Iwanicki, M; Liu, J F; Howitt, B E; Hirsch, M S; Gubbels, J A A; Drapkin, R; Egland, K A. SUSD2 expression in high-grade serous ovarian cancer correlates with increased patient survival and defective mesothelial clearance. Oncogenesis. 2016;5(10):e264. 

Guo, Wei; Shao, Fei; Sun, Sijin; Song, Peng; Guo, Lei; Xue, Xuemin; Zhang, Guochao; Zhang, Hao; Gao, Yibo; Qiu, Bin; Tan, Fengwei; Gao, Shugeng; He, Jie. Loss of SUSD2 expression correlates with poor prognosis in patients with surgically resected lung adenocarcinoma. Journal Of Cancer. 11(7):1648-1656. 

Sheets, Jordan N; Patrick, Mitch E; Egland, Kristi A. SUSD2 expression correlates with decreased metastasis and increased survival in a high-grade serous ovarian cancer xenograft murine model. Oncotarget. 2020;11(24):2290-2301. 

Maynard, Ashley; McCoach, Caroline E; Rotow, Julia K; Harris, Lincoln; Haderk, Franziska; Kerr, D Lucas; Yu, Elizabeth A; Schenk, Erin L; Tan, Weilun; Zee, Alexander; Tan, Michelle; Gui, Philippe; Lea, Tasha; Wu, Wei; Urisman, Anatoly; Jones, Kirk; Sit, Rene; Kolli, Pallav K; Seeley, Eric; Gesthalter, Yaron; Le, Daniel D; Yamauchi, Kevin A; Naeger, David M; Bandyopadhyay, Sourav; Shah, Khyati; Cech, Lauren; Thomas, Nicholas J; Gupta, Anshal; Gonzalez, Mayra; Do, Hien; Tan, Lisa; Bacaltos, Bianca; Gomez-Sjoberg, Rafael; Gubens, Matthew; Jahan, Thierry; Kratz, Johannes R; Jablons, David; Neff, Norma; Doebele, Robert C; Weissman, Jonathan; Blakely, Collin M; Darmanis, Spyros; Bivona, Trever G. Therapy-Induced Evolution of Human Lung Cancer Revealed by Single-Cell RNA Sequencing. Cell. 2020;182(5):1232-1251.e22.