Anti SURF6 pAb (ATL-HPA074622)

Atlas Antibodies

Catalog No.:
ATL-HPA074622-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: surfeit 6
Gene Name: SURF6
Alternative Gene Name: FLJ30322, RRP14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036160: 92%, ENSRNOG00000005031: 89%
Entrez Gene ID: 6838
Uniprot ID: O75683
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEKRQRVKGNLTPLTGRNYRQLLERLQARQSRLDELRGQDEGKAQELEAKMKWTNLLYKAEGVKIRDDERLL
Gene Sequence KEKRQRVKGNLTPLTGRNYRQLLERLQARQSRLDELRGQDEGKAQELEAKMKWTNLLYKAEGVKIRDDERLL
Gene ID - Mouse ENSMUSG00000036160
Gene ID - Rat ENSRNOG00000005031
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SURF6 pAb (ATL-HPA074622)
Datasheet Anti SURF6 pAb (ATL-HPA074622) Datasheet (External Link)
Vendor Page Anti SURF6 pAb (ATL-HPA074622) at Atlas Antibodies

Documents & Links for Anti SURF6 pAb (ATL-HPA074622)
Datasheet Anti SURF6 pAb (ATL-HPA074622) Datasheet (External Link)
Vendor Page Anti SURF6 pAb (ATL-HPA074622)