Anti SUPT6H pAb (ATL-HPA036382)

Atlas Antibodies

Catalog No.:
ATL-HPA036382-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: suppressor of Ty 6 homolog (S. cerevisiae)
Gene Name: SUPT6H
Alternative Gene Name: KIAA0162, SPT6H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002052: 99%, ENSRNOG00000012240: 100%
Entrez Gene ID: 6830
Uniprot ID: Q7KZ85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTTYIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTWKVSDGIYQHVDVREEGKENAFSLGATLWINSEEFEDLDEIVARYVQPM
Gene Sequence RTTYIKRVIAHPSFHNINFKQAEKMMETMDQGDVIIRPSSKGENHLTVTWKVSDGIYQHVDVREEGKENAFSLGATLWINSEEFEDLDEIVARYVQPM
Gene ID - Mouse ENSMUSG00000002052
Gene ID - Rat ENSRNOG00000012240
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SUPT6H pAb (ATL-HPA036382)
Datasheet Anti SUPT6H pAb (ATL-HPA036382) Datasheet (External Link)
Vendor Page Anti SUPT6H pAb (ATL-HPA036382) at Atlas Antibodies

Documents & Links for Anti SUPT6H pAb (ATL-HPA036382)
Datasheet Anti SUPT6H pAb (ATL-HPA036382) Datasheet (External Link)
Vendor Page Anti SUPT6H pAb (ATL-HPA036382)