Anti SULT2B1 pAb (ATL-HPA076510 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA076510-25

Protein Description: sulfotransferase family 2B member 1
Gene Name: SULT2B1
Alternative Gene Name: HSST2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003271: 93%, ENSRNOG00000021046: 89%
Entrez Gene ID: 6820
Uniprot ID: O00204
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KAKVIYMGRNPRDVVVSLYHYSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDH
• Gene Sequence: KAKVIYMGRNPRDVVVSLYHYSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDH
• Gene ID - Mouse: ENSMUSG00000003271
• Gene ID - Rat: ENSRNOG00000021046
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.