Anti SULT2A1 pAb (ATL-HPA063633 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA063633-25

• 
• 

Protein Description: sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA)-preferring, member 1
Gene Name: SULT2A1
Alternative Gene Name: DHEA-ST, STD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070810: 75%, ENSRNOG00000047986: 70%
Entrez Gene ID: 6822
Uniprot ID: Q06520
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIW
• Gene Sequence: EFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIW
• Gene ID - Mouse: ENSMUSG00000070810
• Gene ID - Rat: ENSRNOG00000047986
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.