Anti SULT1B1 pAb (ATL-HPA002107 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002107-100

Protein Description: sulfotransferase family, cytosolic, 1B, member 1
Gene Name: SULT1B1
Alternative Gene Name: ST1B2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029269: 75%, ENSRNOG00000001967: 76%
Entrez Gene ID: 27284
Uniprot ID: O43704
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARN
• Gene Sequence: KIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARN
• Gene ID - Mouse: ENSMUSG00000029269
• Gene ID - Rat: ENSRNOG00000001967
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.