Anti SULF1 pAb (ATL-HPA054728)

Atlas Antibodies

SKU:
ATL-HPA054728-100
  • Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
  • Western blot analysis in human cell line U-138MG.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: sulfatase 1
Gene Name: SULF1
Alternative Gene Name: KIAA1077, SULF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016918: 79%, ENSRNOG00000009037: 78%
Entrez Gene ID: 23213
Uniprot ID: Q8IWU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QPRNIAKRHDEGHKGPRDLQASSGGNRGRMLADSSNAVGPPTTVRVTHKCFILPNDSIHCERELYQSARAWKDHKAYIDKEIEALQD
Gene Sequence QPRNIAKRHDEGHKGPRDLQASSGGNRGRMLADSSNAVGPPTTVRVTHKCFILPNDSIHCERELYQSARAWKDHKAYIDKEIEALQD
Gene ID - Mouse ENSMUSG00000016918
Gene ID - Rat ENSRNOG00000009037
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SULF1 pAb (ATL-HPA054728)
Datasheet Anti SULF1 pAb (ATL-HPA054728) Datasheet (External Link)
Vendor Page Anti SULF1 pAb (ATL-HPA054728) at Atlas Antibodies

Documents & Links for Anti SULF1 pAb (ATL-HPA054728)
Datasheet Anti SULF1 pAb (ATL-HPA054728) Datasheet (External Link)
Vendor Page Anti SULF1 pAb (ATL-HPA054728)



Citations for Anti SULF1 pAb (ATL-HPA054728) – 1 Found
Tyekucheva, Svitlana; Bowden, Michaela; Bango, Clyde; Giunchi, Francesca; Huang, Ying; Zhou, Chensheng; Bondi, Arrigo; Lis, Rosina; Van Hemelrijck, Mieke; Andrén, Ove; Andersson, Sven-Olof; Watson, R William; Pennington, Stephen; Finn, Stephen P; Martin, Neil E; Stampfer, Meir J; Parmigiani, Giovanni; Penney, Kathryn L; Fiorentino, Michelangelo; Mucci, Lorelei A; Loda, Massimo. Stromal and epithelial transcriptional map of initiation progression and metastatic potential of human prostate cancer. Nature Communications. 2017;8(1):420.  PubMed