Anti STX4 pAb (ATL-HPA001330 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001330-25

Protein Description: syntaxin 4
Gene Name: STX4
Alternative Gene Name: p35-2, STX4A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030805: 86%, ENSRNOG00000019302: 86%
Entrez Gene ID: 6810
Uniprot ID: Q12846
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSE
• Gene Sequence: MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSE
• Gene ID - Mouse: ENSMUSG00000030805
• Gene ID - Rat: ENSRNOG00000019302
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti STX4 pAb (ATL-HPA001330 w/enhanced validation) – 6 Found

Shimoda, Yoko; Okada, Shuichi; Yamada, Eijiro; Pessin, Jeffrey E; Yamada, Masanobu. Tctex1d2 Is a Negative Regulator of GLUT4 Translocation and Glucose Uptake. Endocrinology. 2015;156(10):3548-58. 

Gomi, Hiroshi; Osawa, Hiromi; Uno, Rie; Yasui, Tadashi; Hosaka, Masahiro; Torii, Seiji; Tsukise, Azuma. Canine Salivary Glands: Analysis of Rab and SNARE Protein Expression and SNARE Complex Formation With Diverse Tissue Properties. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2017;65(11):637-653. 

Yasui, Tadashi; Gomi, Hiroshi; Kitahara, Taishi; Tsukise, Azuma. Ultrastructure and immunohistochemical characterization of proteins concerned with the secretory machinery in goat ceruminous glands. European Journal Of Histochemistry : Ejh. 2017;61(3):2828. 

Yasui, Tadashi; Miyata, Kenya; Nakatsuka, Chie; Tsukise, Azuma; Gomi, Hiroshi. Morphological and histochemical characterization of the secretory epithelium in the canine lacrimal gland. European Journal Of Histochemistry : Ejh. 2021;65(4) 

Rivero, Rodrigo; Garin, Claire-Alix; Ormazabal, Paulina; Silva, Andrea; Carvajal, Rodrigo; Gabler, Fernando; Romero, Carmen; Vega, Margarita. Protein expression of PKCZ (Protein Kinase C Zeta), Munc18c, and Syntaxin-4 in the insulin pathway in endometria of patients with polycystic ovary syndrome (PCOS). Reproductive Biology And Endocrinology : Rb&E. 2012;10( 22390153):17. 

Campbell-Valois, François-Xavier; Trost, Matthias; Chemali, Magali; Dill, Brian D; Laplante, Annie; Duclos, Sophie; Sadeghi, Shayan; Rondeau, Christiane; Morrow, Isabel C; Bell, Christina; Gagnon, Etienne; Hatsuzawa, Kiyokata; Thibault, Pierre; Desjardins, Michel. Quantitative proteomics reveals that only a subset of the endoplasmic reticulum contributes to the phagosome. Molecular & Cellular Proteomics : Mcp. 2012;11(7):M111.016378.