Anti STX3 pAb (ATL-HPA002191)

Atlas Antibodies

Catalog No.: ATL-HPA002191-25

Protein Description: syntaxin 3
Gene Name: STX3
Alternative Gene Name: STX3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041488: 99%, ENSRNOG00000021013: 99%
Entrez Gene ID: 6809
Uniprot ID: Q13277
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KQLTQDDDTDAVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLYSIILSAPIPEPKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVDFRERSKGRIQRQLEITGK
• Gene Sequence: KQLTQDDDTDAVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLYSIILSAPIPEPKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVDFRERSKGRIQRQLEITGK
• Gene ID - Mouse: ENSMUSG00000041488
• Gene ID - Rat: ENSRNOG00000021013
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti STX3 pAb (ATL-HPA002191) – 2 Found

Datta, Poppy; Allamargot, Chantal; Hudson, Joseph S; Andersen, Emily K; Bhattarai, Sajag; Drack, Arlene V; Sheffield, Val C; Seo, Seongjin. Accumulation of non-outer segment proteins in the outer segment underlies photoreceptor degeneration in Bardet-Biedl syndrome. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2015;112(32):E4400-9. 

Lau, Betty; Kerr, Karen; Camiolo, Salvatore; Nightingale, Katie; Gu, Quan; Antrobus, Robin; Suárez, Nicolás M; Loney, Colin; Stanton, Richard J; Weekes, Michael P; Davison, Andrew J. Human Cytomegalovirus RNA2.7 Is Required for Upregulating Multiple Cellular Genes To Promote Cell Motility and Viral Spread Late in Lytic Infection. Journal Of Virology. 2021;95(20):e0069821.