Anti STX10 pAb (ATL-HPA056439)

Atlas Antibodies

Catalog No.:
ATL-HPA056439-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: syntaxin 10
Gene Name: STX10
Alternative Gene Name: hsyn10, SYN10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026470: 60%, ENSRNOG00000003402: 60%
Entrez Gene ID: 8677
Uniprot ID: O60499
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRM
Gene Sequence MDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRM
Gene ID - Mouse ENSMUSG00000026470
Gene ID - Rat ENSRNOG00000003402
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STX10 pAb (ATL-HPA056439)
Datasheet Anti STX10 pAb (ATL-HPA056439) Datasheet (External Link)
Vendor Page Anti STX10 pAb (ATL-HPA056439) at Atlas Antibodies

Documents & Links for Anti STX10 pAb (ATL-HPA056439)
Datasheet Anti STX10 pAb (ATL-HPA056439) Datasheet (External Link)
Vendor Page Anti STX10 pAb (ATL-HPA056439)