Anti STS pAb (ATL-HPA002904 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002904-25

Protein Description: steroid sulfatase (microsomal), isozyme S
Gene Name: STS
Alternative Gene Name: ARSC, ARSC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015027: 40%, ENSRNOG00000032487: 66%
Entrez Gene ID: 412
Uniprot ID: P08842
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPFLLVLSYLHVHTALFSSKDFAGKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEVSSKGEIHGGSNGIY
• Gene Sequence: YEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPFLLVLSYLHVHTALFSSKDFAGKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEVSSKGEIHGGSNGIY
• Gene ID - Mouse: ENSMUSG00000015027
• Gene ID - Rat: ENSRNOG00000032487
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti STS pAb (ATL-HPA002904 w/enhanced validation) – 3 Found

Colette, S; Defrère, S; Lousse, J C; Van Langendonckt, A; Gotteland, J P; Loumaye, E; Donnez, J. Inhibition of steroid sulfatase decreases endometriosis in an in vivo murine model. Human Reproduction (Oxford, England). 2011;26(6):1362-70. 

Drukker, Micha; Tang, Chad; Ardehali, Reza; Rinkevich, Yuval; Seita, Jun; Lee, Andrew S; Mosley, Adriane R; Weissman, Irving L; Soen, Yoav. Isolation of primitive endoderm, mesoderm, vascular endothelial and trophoblast progenitors from human pluripotent stem cells. Nature Biotechnology. 2012;30(6):531-42. 

Ren, Xia; Wu, Xuan; Hillier, Stephen G; Fegan, K Scott; Critchley, Hilary O D; Mason, J Ian; Sarvi, Sana; Harlow, Christopher R. Local estrogen metabolism in epithelial ovarian cancer suggests novel targets for therapy. The Journal Of Steroid Biochemistry And Molecular Biology. 2015;150( 25817828):54-63.