Anti STRN4 pAb (ATL-HPA043051)

Atlas Antibodies

Catalog No.: ATL-HPA043051-25

Protein Description: striatin, calmodulin binding protein 4
Gene Name: STRN4
Alternative Gene Name: ZIN, zinedin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030374: 97%, ENSRNOG00000016145: 97%
Entrez Gene ID: 29888
Uniprot ID: Q9NRL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLSGGESLLVKQIEEQIKRNAAGKDGKERLGGSVLGQIPFLQNCEDEDSDEDDELDSVQHKKQRVKLPSKALVPEMEDE
• Gene Sequence: GLSGGESLLVKQIEEQIKRNAAGKDGKERLGGSVLGQIPFLQNCEDEDSDEDDELDSVQHKKQRVKLPSKALVPEMEDE
• Gene ID - Mouse: ENSMUSG00000030374
• Gene ID - Rat: ENSRNOG00000016145
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti STRN4 pAb (ATL-HPA043051) – 1 Found

Czauderna, Carolin; Poplawski, Alicia; O'Rourke, Colm J; Castven, Darko; Pérez-Aguilar, Benjamín; Becker, Diana; Heilmann-Heimbach, Stephanie; Odenthal, Margarete; Amer, Wafa; Schmiel, Marcel; Drebber, Uta; Binder, Harald; Ridder, Dirk A; Schindeldecker, Mario; Straub, Beate K; Galle, Peter R; Andersen, Jesper B; Thorgeirsson, Snorri S; Park, Young Nyun; Marquardt, Jens U. Epigenetic modifications precede molecular alterations and drive human hepatocarcinogenesis. Jci Insight. 2021;6(17)