Anti STRIP2 pAb (ATL-HPA019657)

Atlas Antibodies

Catalog No.:
ATL-HPA019657-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: striatin interacting protein 2
Gene Name: STRIP2
Alternative Gene Name: FAM40B, FAR11B, KIAA1170
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039629: 97%, ENSRNOG00000057729: 93%
Entrez Gene ID: 57464
Uniprot ID: Q9ULQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GFEHLQTLKVQKRAELGLPPLAEDSIQVVKSMRAASPPSYTLDLGESQLAPPPSKLRGRRGSRRQLLTKQDSLDIY
Gene Sequence GFEHLQTLKVQKRAELGLPPLAEDSIQVVKSMRAASPPSYTLDLGESQLAPPPSKLRGRRGSRRQLLTKQDSLDIY
Gene ID - Mouse ENSMUSG00000039629
Gene ID - Rat ENSRNOG00000057729
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STRIP2 pAb (ATL-HPA019657)
Datasheet Anti STRIP2 pAb (ATL-HPA019657) Datasheet (External Link)
Vendor Page Anti STRIP2 pAb (ATL-HPA019657) at Atlas Antibodies

Documents & Links for Anti STRIP2 pAb (ATL-HPA019657)
Datasheet Anti STRIP2 pAb (ATL-HPA019657) Datasheet (External Link)
Vendor Page Anti STRIP2 pAb (ATL-HPA019657)
Citations for Anti STRIP2 pAb (ATL-HPA019657) – 1 Found
Eden, Matthias; Meder, Benjamin; Völkers, Mirko; Poomvanicha, Montatip; Domes, Katrin; Branchereau, M; Marck, P; Will, Rainer; Bernt, Alexander; Rangrez, Ashraf; Busch, Matthias; Hrabě de Angelis, Martin; Heymes, Christophe; Rottbauer, Wolfgang; Most, Patrick; Hofmann, Franz; Frey, Norbert. Myoscape controls cardiac calcium cycling and contractility via regulation of L-type calcium channel surface expression. Nature Communications. 2016;7( 27122098):11317.  PubMed