Anti STRIP2 pAb (ATL-HPA019657)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019657-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: STRIP2
Alternative Gene Name: FAM40B, FAR11B, KIAA1170
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039629: 97%, ENSRNOG00000057729: 93%
Entrez Gene ID: 57464
Uniprot ID: Q9ULQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GFEHLQTLKVQKRAELGLPPLAEDSIQVVKSMRAASPPSYTLDLGESQLAPPPSKLRGRRGSRRQLLTKQDSLDIY |
| Gene Sequence | GFEHLQTLKVQKRAELGLPPLAEDSIQVVKSMRAASPPSYTLDLGESQLAPPPSKLRGRRGSRRQLLTKQDSLDIY |
| Gene ID - Mouse | ENSMUSG00000039629 |
| Gene ID - Rat | ENSRNOG00000057729 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti STRIP2 pAb (ATL-HPA019657) | |
| Datasheet | Anti STRIP2 pAb (ATL-HPA019657) Datasheet (External Link) |
| Vendor Page | Anti STRIP2 pAb (ATL-HPA019657) at Atlas Antibodies |
| Documents & Links for Anti STRIP2 pAb (ATL-HPA019657) | |
| Datasheet | Anti STRIP2 pAb (ATL-HPA019657) Datasheet (External Link) |
| Vendor Page | Anti STRIP2 pAb (ATL-HPA019657) |
| Citations for Anti STRIP2 pAb (ATL-HPA019657) – 1 Found |
| Eden, Matthias; Meder, Benjamin; Völkers, Mirko; Poomvanicha, Montatip; Domes, Katrin; Branchereau, M; Marck, P; Will, Rainer; Bernt, Alexander; Rangrez, Ashraf; Busch, Matthias; Hrabě de Angelis, Martin; Heymes, Christophe; Rottbauer, Wolfgang; Most, Patrick; Hofmann, Franz; Frey, Norbert. Myoscape controls cardiac calcium cycling and contractility via regulation of L-type calcium channel surface expression. Nature Communications. 2016;7( 27122098):11317. PubMed |