Anti STRIP1 pAb (ATL-HPA060498)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060498-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: STRIP1
Alternative Gene Name: FAM40A, FAR11A, FLJ14743, KIAA1761
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014601: 100%, ENSRNOG00000018293: 100%
Entrez Gene ID: 85369
Uniprot ID: Q5VSL9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DSIKVIRNMRAASPPASASDLIEQQQKRGRREHKALIKQDNLDAFNERDPYKADDSREEE |
| Gene Sequence | DSIKVIRNMRAASPPASASDLIEQQQKRGRREHKALIKQDNLDAFNERDPYKADDSREEE |
| Gene ID - Mouse | ENSMUSG00000014601 |
| Gene ID - Rat | ENSRNOG00000018293 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti STRIP1 pAb (ATL-HPA060498) | |
| Datasheet | Anti STRIP1 pAb (ATL-HPA060498) Datasheet (External Link) |
| Vendor Page | Anti STRIP1 pAb (ATL-HPA060498) at Atlas Antibodies |
| Documents & Links for Anti STRIP1 pAb (ATL-HPA060498) | |
| Datasheet | Anti STRIP1 pAb (ATL-HPA060498) Datasheet (External Link) |
| Vendor Page | Anti STRIP1 pAb (ATL-HPA060498) |