Anti STRIP1 pAb (ATL-HPA060498)

Atlas Antibodies

Catalog No.:
ATL-HPA060498-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: striatin interacting protein 1
Gene Name: STRIP1
Alternative Gene Name: FAM40A, FAR11A, FLJ14743, KIAA1761
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014601: 100%, ENSRNOG00000018293: 100%
Entrez Gene ID: 85369
Uniprot ID: Q5VSL9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSIKVIRNMRAASPPASASDLIEQQQKRGRREHKALIKQDNLDAFNERDPYKADDSREEE
Gene Sequence DSIKVIRNMRAASPPASASDLIEQQQKRGRREHKALIKQDNLDAFNERDPYKADDSREEE
Gene ID - Mouse ENSMUSG00000014601
Gene ID - Rat ENSRNOG00000018293
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STRIP1 pAb (ATL-HPA060498)
Datasheet Anti STRIP1 pAb (ATL-HPA060498) Datasheet (External Link)
Vendor Page Anti STRIP1 pAb (ATL-HPA060498) at Atlas Antibodies

Documents & Links for Anti STRIP1 pAb (ATL-HPA060498)
Datasheet Anti STRIP1 pAb (ATL-HPA060498) Datasheet (External Link)
Vendor Page Anti STRIP1 pAb (ATL-HPA060498)