Anti STRC pAb (ATL-HPA048083)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048083-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: STRC
Alternative Gene Name: DFNB16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033498: 86%, ENSRNOG00000014845: 87%
Entrez Gene ID: 161497
Uniprot ID: Q7RTU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LPTRVRGSLRACIWAELQRRMAMPEPEWTTVGPELNGLDSKLLLDLPIQLMDRLSNESIMLVVELVQRAPEQLLALTPLHQAALAERALQNLAPKETPVSGEVLETLGPLVGFLG |
Gene Sequence | LPTRVRGSLRACIWAELQRRMAMPEPEWTTVGPELNGLDSKLLLDLPIQLMDRLSNESIMLVVELVQRAPEQLLALTPLHQAALAERALQNLAPKETPVSGEVLETLGPLVGFLG |
Gene ID - Mouse | ENSMUSG00000033498 |
Gene ID - Rat | ENSRNOG00000014845 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti STRC pAb (ATL-HPA048083) | |
Datasheet | Anti STRC pAb (ATL-HPA048083) Datasheet (External Link) |
Vendor Page | Anti STRC pAb (ATL-HPA048083) at Atlas Antibodies |
Documents & Links for Anti STRC pAb (ATL-HPA048083) | |
Datasheet | Anti STRC pAb (ATL-HPA048083) Datasheet (External Link) |
Vendor Page | Anti STRC pAb (ATL-HPA048083) |