Anti STRC pAb (ATL-HPA048083)

Atlas Antibodies

Catalog No.:
ATL-HPA048083-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: stereocilin
Gene Name: STRC
Alternative Gene Name: DFNB16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033498: 86%, ENSRNOG00000014845: 87%
Entrez Gene ID: 161497
Uniprot ID: Q7RTU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPTRVRGSLRACIWAELQRRMAMPEPEWTTVGPELNGLDSKLLLDLPIQLMDRLSNESIMLVVELVQRAPEQLLALTPLHQAALAERALQNLAPKETPVSGEVLETLGPLVGFLG
Gene Sequence LPTRVRGSLRACIWAELQRRMAMPEPEWTTVGPELNGLDSKLLLDLPIQLMDRLSNESIMLVVELVQRAPEQLLALTPLHQAALAERALQNLAPKETPVSGEVLETLGPLVGFLG
Gene ID - Mouse ENSMUSG00000033498
Gene ID - Rat ENSRNOG00000014845
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STRC pAb (ATL-HPA048083)
Datasheet Anti STRC pAb (ATL-HPA048083) Datasheet (External Link)
Vendor Page Anti STRC pAb (ATL-HPA048083) at Atlas Antibodies

Documents & Links for Anti STRC pAb (ATL-HPA048083)
Datasheet Anti STRC pAb (ATL-HPA048083) Datasheet (External Link)
Vendor Page Anti STRC pAb (ATL-HPA048083)