Anti STRC pAb (ATL-HPA048083)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048083-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: STRC
Alternative Gene Name: DFNB16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033498: 86%, ENSRNOG00000014845: 87%
Entrez Gene ID: 161497
Uniprot ID: Q7RTU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LPTRVRGSLRACIWAELQRRMAMPEPEWTTVGPELNGLDSKLLLDLPIQLMDRLSNESIMLVVELVQRAPEQLLALTPLHQAALAERALQNLAPKETPVSGEVLETLGPLVGFLG |
| Gene Sequence | LPTRVRGSLRACIWAELQRRMAMPEPEWTTVGPELNGLDSKLLLDLPIQLMDRLSNESIMLVVELVQRAPEQLLALTPLHQAALAERALQNLAPKETPVSGEVLETLGPLVGFLG |
| Gene ID - Mouse | ENSMUSG00000033498 |
| Gene ID - Rat | ENSRNOG00000014845 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti STRC pAb (ATL-HPA048083) | |
| Datasheet | Anti STRC pAb (ATL-HPA048083) Datasheet (External Link) |
| Vendor Page | Anti STRC pAb (ATL-HPA048083) at Atlas Antibodies |
| Documents & Links for Anti STRC pAb (ATL-HPA048083) | |
| Datasheet | Anti STRC pAb (ATL-HPA048083) Datasheet (External Link) |
| Vendor Page | Anti STRC pAb (ATL-HPA048083) |