Anti STRADB pAb (ATL-HPA028520)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028520-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: STRADB
Alternative Gene Name: ALS2CR2, CALS-21, ILPIP, ILPIPA, PAPK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026027: 86%, ENSRNOG00000010728: 88%
Entrez Gene ID: 55437
Uniprot ID: Q9C0K7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDE |
| Gene Sequence | FSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDE |
| Gene ID - Mouse | ENSMUSG00000026027 |
| Gene ID - Rat | ENSRNOG00000010728 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti STRADB pAb (ATL-HPA028520) | |
| Datasheet | Anti STRADB pAb (ATL-HPA028520) Datasheet (External Link) |
| Vendor Page | Anti STRADB pAb (ATL-HPA028520) at Atlas Antibodies |
| Documents & Links for Anti STRADB pAb (ATL-HPA028520) | |
| Datasheet | Anti STRADB pAb (ATL-HPA028520) Datasheet (External Link) |
| Vendor Page | Anti STRADB pAb (ATL-HPA028520) |