Anti STRADB pAb (ATL-HPA028520)

Atlas Antibodies

Catalog No.: ATL-HPA028520-25

Protein Description: STE20-related kinase adaptor beta
Gene Name: STRADB
Alternative Gene Name: ALS2CR2, CALS-21, ILPIP, ILPIPA, PAPK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026027: 86%, ENSRNOG00000010728: 88%
Entrez Gene ID: 55437
Uniprot ID: Q9C0K7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDE
• Gene Sequence: FSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDE
• Gene ID - Mouse: ENSMUSG00000026027
• Gene ID - Rat: ENSRNOG00000010728
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.