Anti STRADA pAb (ATL-HPA031637)

Atlas Antibodies

Catalog No.: ATL-HPA031637-25

Protein Description: STE20-related kinase adaptor alpha
Gene Name: STRADA
Alternative Gene Name: LYK5, NY-BR-96, Stlk, STRAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069631: 92%, ENSRNOG00000008637: 91%
Entrez Gene ID: 92335
Uniprot ID: Q7RTN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARPSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSG
• Gene Sequence: MLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARPSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSG
• Gene ID - Mouse: ENSMUSG00000069631
• Gene ID - Rat: ENSRNOG00000008637
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.