Anti STOX2 pAb (ATL-HPA049776)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049776-100
- Shipping:
- Calculated at Checkout
        
            
        
        
        $596.00
    
         
                            Gene Name: STOX2
Alternative Gene Name: DKFZp762K222
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038143: 94%, ENSRNOG00000009590: 91%
Entrez Gene ID: 56977
Uniprot ID: Q9P2F5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | HLDERIPDRSQCTSPQPGTITPSASGCVRERTLPRNHCDSCHCCREDVHSTHAPTLQRKSAKDCKDPYCPPSLCQVPPTEKSKSTVNFSYKTETLSKPK | 
| Gene Sequence | HLDERIPDRSQCTSPQPGTITPSASGCVRERTLPRNHCDSCHCCREDVHSTHAPTLQRKSAKDCKDPYCPPSLCQVPPTEKSKSTVNFSYKTETLSKPK | 
| Gene ID - Mouse | ENSMUSG00000038143 | 
| Gene ID - Rat | ENSRNOG00000009590 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti STOX2 pAb (ATL-HPA049776) | |
| Datasheet | Anti STOX2 pAb (ATL-HPA049776) Datasheet (External Link) | 
| Vendor Page | Anti STOX2 pAb (ATL-HPA049776) at Atlas Antibodies | 
| Documents & Links for Anti STOX2 pAb (ATL-HPA049776) | |
| Datasheet | Anti STOX2 pAb (ATL-HPA049776) Datasheet (External Link) | 
| Vendor Page | Anti STOX2 pAb (ATL-HPA049776) | 
 
         
                             
                                        