Anti STOX2 pAb (ATL-HPA049776)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049776-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: STOX2
Alternative Gene Name: DKFZp762K222
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038143: 94%, ENSRNOG00000009590: 91%
Entrez Gene ID: 56977
Uniprot ID: Q9P2F5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HLDERIPDRSQCTSPQPGTITPSASGCVRERTLPRNHCDSCHCCREDVHSTHAPTLQRKSAKDCKDPYCPPSLCQVPPTEKSKSTVNFSYKTETLSKPK |
| Gene Sequence | HLDERIPDRSQCTSPQPGTITPSASGCVRERTLPRNHCDSCHCCREDVHSTHAPTLQRKSAKDCKDPYCPPSLCQVPPTEKSKSTVNFSYKTETLSKPK |
| Gene ID - Mouse | ENSMUSG00000038143 |
| Gene ID - Rat | ENSRNOG00000009590 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti STOX2 pAb (ATL-HPA049776) | |
| Datasheet | Anti STOX2 pAb (ATL-HPA049776) Datasheet (External Link) |
| Vendor Page | Anti STOX2 pAb (ATL-HPA049776) at Atlas Antibodies |
| Documents & Links for Anti STOX2 pAb (ATL-HPA049776) | |
| Datasheet | Anti STOX2 pAb (ATL-HPA049776) Datasheet (External Link) |
| Vendor Page | Anti STOX2 pAb (ATL-HPA049776) |