Anti STN1 pAb (ATL-HPA037925)

Atlas Antibodies

Catalog No.: ATL-HPA037925-100

Protein Description: STN1, CST complex subunit
Gene Name: STN1
Alternative Gene Name: bA541N10.2, FLJ22559, OBFC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042694: 72%, ENSRNOG00000020376: 71%
Entrez Gene ID: 79991
Uniprot ID: Q9H668
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVFLAFAKLYIRDILDMKESRQVPGVFLYNGHPIKQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESVSAAPSAARELSLTSQLKKLQETIEQKTKI
• Gene Sequence: PVFLAFAKLYIRDILDMKESRQVPGVFLYNGHPIKQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESVSAAPSAARELSLTSQLKKLQETIEQKTKI
• Gene ID - Mouse: ENSMUSG00000042694
• Gene ID - Rat: ENSRNOG00000020376
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.