Anti STMND1 pAb (ATL-HPA067970 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA067970-25
  • Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-STMND1 antibody. Corresponding STMND1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to actin filaments.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: stathmin domain containing 1
Gene Name: STMND1
Alternative Gene Name: FLJ23152
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063529: 51%, ENSRNOG00000031595: 49%
Entrez Gene ID: 401236
Uniprot ID: H3BQB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AEVAFAKGLQRVRSAGFEPSDLQGGKPLKRKKSKCDATLIDRNESDESFGVVESDMSYNQA
Gene Sequence AEVAFAKGLQRVRSAGFEPSDLQGGKPLKRKKSKCDATLIDRNESDESFGVVESDMSYNQA
Gene ID - Mouse ENSMUSG00000063529
Gene ID - Rat ENSRNOG00000031595
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti STMND1 pAb (ATL-HPA067970 w/enhanced validation)
Datasheet Anti STMND1 pAb (ATL-HPA067970 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti STMND1 pAb (ATL-HPA067970 w/enhanced validation)