Anti STK35 pAb (ATL-HPA051673)

Atlas Antibodies

Catalog No.:
ATL-HPA051673-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: serine/threonine kinase 35
Gene Name: STK35
Alternative Gene Name: bA550O8.2, CLIK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037885: 95%, ENSRNOG00000006002: 95%
Entrez Gene ID: 140901
Uniprot ID: Q8TDR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSLKRRHQNVVQFEECVLQRNGLAQRMSHGNKSSQLYLRLVET
Gene Sequence TSLKRRHQNVVQFEECVLQRNGLAQRMSHGNKSSQLYLRLVET
Gene ID - Mouse ENSMUSG00000037885
Gene ID - Rat ENSRNOG00000006002
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STK35 pAb (ATL-HPA051673)
Datasheet Anti STK35 pAb (ATL-HPA051673) Datasheet (External Link)
Vendor Page Anti STK35 pAb (ATL-HPA051673) at Atlas Antibodies

Documents & Links for Anti STK35 pAb (ATL-HPA051673)
Datasheet Anti STK35 pAb (ATL-HPA051673) Datasheet (External Link)
Vendor Page Anti STK35 pAb (ATL-HPA051673)
Citations for Anti STK35 pAb (ATL-HPA051673) – 1 Found
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.  PubMed