Anti STK35 pAb (ATL-HPA026452)

Atlas Antibodies

Catalog No.:
ATL-HPA026452-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: serine/threonine kinase 35
Gene Name: STK35
Alternative Gene Name: bA550O8.2, CLIK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037885: 97%, ENSRNOG00000006002: 97%
Entrez Gene ID: 140901
Uniprot ID: Q8TDR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSLKRRHQNVVQFEECVLQRNGLAQRMSHGNKSSQLYLRLVETSLKGERILGYAEEPCYLWF
Gene Sequence TSLKRRHQNVVQFEECVLQRNGLAQRMSHGNKSSQLYLRLVETSLKGERILGYAEEPCYLWF
Gene ID - Mouse ENSMUSG00000037885
Gene ID - Rat ENSRNOG00000006002
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STK35 pAb (ATL-HPA026452)
Datasheet Anti STK35 pAb (ATL-HPA026452) Datasheet (External Link)
Vendor Page Anti STK35 pAb (ATL-HPA026452) at Atlas Antibodies

Documents & Links for Anti STK35 pAb (ATL-HPA026452)
Datasheet Anti STK35 pAb (ATL-HPA026452) Datasheet (External Link)
Vendor Page Anti STK35 pAb (ATL-HPA026452)