Anti STK33 pAb (ATL-HPA056855)

Atlas Antibodies

SKU:
ATL-HPA056855-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in spermatogonia.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: serine/threonine kinase 33
Gene Name: STK33
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031027: 29%, ENSRNOG00000014590: 36%
Entrez Gene ID: 65975
Uniprot ID: Q9BYT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEKLKSYQPWGNVPDANYTSDEEEEKQSTAYEKQFPATSKDNFDMCSSSFTSSKLLPAEIKGEMEKTPVTPSQGTATKYPAKS
Gene Sequence EEKLKSYQPWGNVPDANYTSDEEEEKQSTAYEKQFPATSKDNFDMCSSSFTSSKLLPAEIKGEMEKTPVTPSQGTATKYPAKS
Gene ID - Mouse ENSMUSG00000031027
Gene ID - Rat ENSRNOG00000014590
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti STK33 pAb (ATL-HPA056855)
Datasheet Anti STK33 pAb (ATL-HPA056855) Datasheet (External Link)
Vendor Page Anti STK33 pAb (ATL-HPA056855) at Atlas Antibodies

Documents & Links for Anti STK33 pAb (ATL-HPA056855)
Datasheet Anti STK33 pAb (ATL-HPA056855) Datasheet (External Link)
Vendor Page Anti STK33 pAb (ATL-HPA056855)