Anti STK32B pAb (ATL-HPA058536)

Atlas Antibodies

Catalog No.:
ATL-HPA058536-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: serine/threonine kinase 32B
Gene Name: STK32B
Alternative Gene Name: HSA250839, STK32, STKG6, YANK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029123: 86%, ENSRNOG00000031397: 84%
Entrez Gene ID: 55351
Uniprot ID: Q9NY57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRKLLTKDPESRVSSLHDIQSVPYLADMNWDAVFKKALMPGFV
Gene Sequence LRKLLTKDPESRVSSLHDIQSVPYLADMNWDAVFKKALMPGFV
Gene ID - Mouse ENSMUSG00000029123
Gene ID - Rat ENSRNOG00000031397
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STK32B pAb (ATL-HPA058536)
Datasheet Anti STK32B pAb (ATL-HPA058536) Datasheet (External Link)
Vendor Page Anti STK32B pAb (ATL-HPA058536) at Atlas Antibodies

Documents & Links for Anti STK32B pAb (ATL-HPA058536)
Datasheet Anti STK32B pAb (ATL-HPA058536) Datasheet (External Link)
Vendor Page Anti STK32B pAb (ATL-HPA058536)