Anti STK32B pAb (ATL-HPA058536)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058536-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: STK32B
Alternative Gene Name: HSA250839, STK32, STKG6, YANK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029123: 86%, ENSRNOG00000031397: 84%
Entrez Gene ID: 55351
Uniprot ID: Q9NY57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LRKLLTKDPESRVSSLHDIQSVPYLADMNWDAVFKKALMPGFV |
| Gene Sequence | LRKLLTKDPESRVSSLHDIQSVPYLADMNWDAVFKKALMPGFV |
| Gene ID - Mouse | ENSMUSG00000029123 |
| Gene ID - Rat | ENSRNOG00000031397 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti STK32B pAb (ATL-HPA058536) | |
| Datasheet | Anti STK32B pAb (ATL-HPA058536) Datasheet (External Link) |
| Vendor Page | Anti STK32B pAb (ATL-HPA058536) at Atlas Antibodies |
| Documents & Links for Anti STK32B pAb (ATL-HPA058536) | |
| Datasheet | Anti STK32B pAb (ATL-HPA058536) Datasheet (External Link) |
| Vendor Page | Anti STK32B pAb (ATL-HPA058536) |