Anti STK3 pAb (ATL-HPA007120)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007120-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: STK3
Alternative Gene Name: KRS1, MST2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022329: 89%, ENSRNOG00000011278: 95%
Entrez Gene ID: 6788
Uniprot ID: Q13188
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPMSKNVFPDNWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREI |
| Gene Sequence | ATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPMSKNVFPDNWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREI |
| Gene ID - Mouse | ENSMUSG00000022329 |
| Gene ID - Rat | ENSRNOG00000011278 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti STK3 pAb (ATL-HPA007120) | |
| Datasheet | Anti STK3 pAb (ATL-HPA007120) Datasheet (External Link) |
| Vendor Page | Anti STK3 pAb (ATL-HPA007120) at Atlas Antibodies |
| Documents & Links for Anti STK3 pAb (ATL-HPA007120) | |
| Datasheet | Anti STK3 pAb (ATL-HPA007120) Datasheet (External Link) |
| Vendor Page | Anti STK3 pAb (ATL-HPA007120) |