Anti STK24 pAb (ATL-HPA026435 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA026435-25

Protein Description: serine/threonine kinase 24
Gene Name: STK24
Alternative Gene Name: MST-3, MST3, MST3B, STE20, STK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063410: 100%, ENSRNOG00000011511: 100%
Entrez Gene ID: 8428
Uniprot ID: Q9Y6E0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGG
• Gene Sequence: QCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGG
• Gene ID - Mouse: ENSMUSG00000063410
• Gene ID - Rat: ENSRNOG00000011511
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.