Anti STK16 pAb (ATL-HPA029450)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029450-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: STK16
Alternative Gene Name: MPSK, PKL12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026201: 91%, ENSRNOG00000019294: 94%
Entrez Gene ID: 8576
Uniprot ID: O75716
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIHAKGY |
| Gene Sequence | CSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIHAKGY |
| Gene ID - Mouse | ENSMUSG00000026201 |
| Gene ID - Rat | ENSRNOG00000019294 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti STK16 pAb (ATL-HPA029450) | |
| Datasheet | Anti STK16 pAb (ATL-HPA029450) Datasheet (External Link) |
| Vendor Page | Anti STK16 pAb (ATL-HPA029450) at Atlas Antibodies |
| Documents & Links for Anti STK16 pAb (ATL-HPA029450) | |
| Datasheet | Anti STK16 pAb (ATL-HPA029450) Datasheet (External Link) |
| Vendor Page | Anti STK16 pAb (ATL-HPA029450) |