Anti STK11IP pAb (ATL-HPA053192)

Atlas Antibodies

Catalog No.:
ATL-HPA053192-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: serine/threonine kinase 11 interacting protein
Gene Name: STK11IP
Alternative Gene Name: KIAA1898, LIP1, LKB1IP, STK11IP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026213: 66%, ENSRNOG00000020107: 68%
Entrez Gene ID: 114790
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVLEPDAHAAVQELLAVLTPVTNVAREQLGEARDLLLGRFQCLRCGHEFKPEEPRMGLDSEEGWRPLFQKTESPAVC
Gene Sequence LVLEPDAHAAVQELLAVLTPVTNVAREQLGEARDLLLGRFQCLRCGHEFKPEEPRMGLDSEEGWRPLFQKTESPAVC
Gene ID - Mouse ENSMUSG00000026213
Gene ID - Rat ENSRNOG00000020107
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STK11IP pAb (ATL-HPA053192)
Datasheet Anti STK11IP pAb (ATL-HPA053192) Datasheet (External Link)
Vendor Page Anti STK11IP pAb (ATL-HPA053192) at Atlas Antibodies

Documents & Links for Anti STK11IP pAb (ATL-HPA053192)
Datasheet Anti STK11IP pAb (ATL-HPA053192) Datasheet (External Link)
Vendor Page Anti STK11IP pAb (ATL-HPA053192)