Anti STK11 pAb (ATL-HPA067481)

Atlas Antibodies

Catalog No.: ATL-HPA067481-25

Protein Description: serine/threonine kinase 11
Gene Name: STK11
Alternative Gene Name: LKB1, PJS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003068: 71%, ENSRNOG00000014287: 73%
Entrez Gene ID: 6794
Uniprot ID: Q15831
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIR
• Gene Sequence: DEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIR
• Gene ID - Mouse: ENSMUSG00000003068
• Gene ID - Rat: ENSRNOG00000014287
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.