Anti STK11 pAb (ATL-HPA067481)

Atlas Antibodies

SKU:
ATL-HPA067481-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: serine/threonine kinase 11
Gene Name: STK11
Alternative Gene Name: LKB1, PJS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003068: 71%, ENSRNOG00000014287: 73%
Entrez Gene ID: 6794
Uniprot ID: Q15831
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIR
Gene Sequence DEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIR
Gene ID - Mouse ENSMUSG00000003068
Gene ID - Rat ENSRNOG00000014287
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti STK11 pAb (ATL-HPA067481)
Datasheet Anti STK11 pAb (ATL-HPA067481) Datasheet (External Link)
Vendor Page Anti STK11 pAb (ATL-HPA067481) at Atlas Antibodies

Documents & Links for Anti STK11 pAb (ATL-HPA067481)
Datasheet Anti STK11 pAb (ATL-HPA067481) Datasheet (External Link)
Vendor Page Anti STK11 pAb (ATL-HPA067481)