Anti STIM2 pAb (ATL-HPA057511)

Atlas Antibodies

Catalog No.:
ATL-HPA057511-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: stromal interaction molecule 2
Gene Name: STIM2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039156: 87%, ENSRNOG00000002956: 86%
Entrez Gene ID: 57620
Uniprot ID: Q9P246
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSIPPYPIAGGVDDLDEDTPPIVSQFPGTMAKPPGSLARSSSLCRSRRSIVPSSPQPQRAQLAPHAPHPSHPRHPHHPQHTPHS
Gene Sequence VSIPPYPIAGGVDDLDEDTPPIVSQFPGTMAKPPGSLARSSSLCRSRRSIVPSSPQPQRAQLAPHAPHPSHPRHPHHPQHTPHS
Gene ID - Mouse ENSMUSG00000039156
Gene ID - Rat ENSRNOG00000002956
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STIM2 pAb (ATL-HPA057511)
Datasheet Anti STIM2 pAb (ATL-HPA057511) Datasheet (External Link)
Vendor Page Anti STIM2 pAb (ATL-HPA057511) at Atlas Antibodies

Documents & Links for Anti STIM2 pAb (ATL-HPA057511)
Datasheet Anti STIM2 pAb (ATL-HPA057511) Datasheet (External Link)
Vendor Page Anti STIM2 pAb (ATL-HPA057511)