Anti STC1 pAb (ATL-HPA023918)

Atlas Antibodies

Catalog No.: ATL-HPA023918-25

Protein Description: stanniocalcin 1
Gene Name: STC1
Alternative Gene Name: STC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014813: 100%, ENSRNOG00000015075: 100%
Entrez Gene ID: 6781
Uniprot ID: P52823
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EQNDSVSPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESL
• Gene Sequence: EQNDSVSPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESL
• Gene ID - Mouse: ENSMUSG00000014813
• Gene ID - Rat: ENSRNOG00000015075
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti STC1 pAb (ATL-HPA023918) – 5 Found

Brantley, Kristen D; Kjærsgaard, Anders; Cronin-Fenton, Deirdre; Yacoub, Rami; Nielsen, Anja S; Lauridsen, Kristina L; Hamilton-Dutoit, Stephen; Lash, Timothy L. Stanniocalcin Expression as a Predictor of Late Breast Cancer Recurrence. Cancer Epidemiology, Biomarkers & Prevention : A Publication Of The American Association For Cancer Research, Cosponsored By The American Society Of Preventive Oncology. 2018;27(6):653-659. 

Khatun, Masuma; Urpilainen, Elina; Ahtikoski, Anne; Arffman, Riikka K; Pasanen, Annukka; Puistola, Ulla; Tapanainen, Juha S; Andersson, Leif C; Butzow, Ralf; Loukovaara, Mikko; Piltonen, Terhi T. Low Expression of Stanniocalcin 1 (STC-1) Protein Is Associated With Poor Clinicopathologic Features of Endometrial Cancer. Pathology Oncology Research : Por. 27( 34650342):1609936. 

Ezure, Tomonobu; Amano, Satoshi. Stanniocalcin-1 mediates negative regulatory action of epidermal layer on expression of matrix-related genes in dermal fibroblasts. Biofactors (Oxford, England). 2019;45(6):944-949. 

Khatun, Masuma; Arffman, Riikka K; Lavogina, Darja; Kangasniemi, Marika; Laru, Johanna; Ahtikoski, Anne; Lehtonen, Siri; Paulson, Mariana; Hirschberg, Angelica Lindén; Salumets, Andres; Andersson, Leif C; Piltonen, Terhi T. Women with polycystic ovary syndrome present with altered endometrial expression of stanniocalcin-1†. Biology Of Reproduction. 2020;102(2):306-315. 

Leung, Cherry C T; Wong, Chris K C. Effects of stanniocalcin-1 overexpressing hepatocellular carcinoma cells on macrophage migration. Plos One. 15(11):e0241932.