Anti STAU1 pAb (ATL-HPA049892)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049892-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: STAU1
Alternative Gene Name: PPP1R150, STAU
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039536: 93%, ENSRNOG00000007781: 93%
Entrez Gene ID: 6780
Uniprot ID: O95793
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCG |
Gene Sequence | TRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCG |
Gene ID - Mouse | ENSMUSG00000039536 |
Gene ID - Rat | ENSRNOG00000007781 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti STAU1 pAb (ATL-HPA049892) | |
Datasheet | Anti STAU1 pAb (ATL-HPA049892) Datasheet (External Link) |
Vendor Page | Anti STAU1 pAb (ATL-HPA049892) at Atlas Antibodies |
Documents & Links for Anti STAU1 pAb (ATL-HPA049892) | |
Datasheet | Anti STAU1 pAb (ATL-HPA049892) Datasheet (External Link) |
Vendor Page | Anti STAU1 pAb (ATL-HPA049892) |