Anti STAU1 pAb (ATL-HPA049892)

Atlas Antibodies

Catalog No.:
ATL-HPA049892-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: staufen double-stranded RNA binding protein 1
Gene Name: STAU1
Alternative Gene Name: PPP1R150, STAU
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039536: 93%, ENSRNOG00000007781: 93%
Entrez Gene ID: 6780
Uniprot ID: O95793
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCG
Gene Sequence TRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCG
Gene ID - Mouse ENSMUSG00000039536
Gene ID - Rat ENSRNOG00000007781
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STAU1 pAb (ATL-HPA049892)
Datasheet Anti STAU1 pAb (ATL-HPA049892) Datasheet (External Link)
Vendor Page Anti STAU1 pAb (ATL-HPA049892) at Atlas Antibodies

Documents & Links for Anti STAU1 pAb (ATL-HPA049892)
Datasheet Anti STAU1 pAb (ATL-HPA049892) Datasheet (External Link)
Vendor Page Anti STAU1 pAb (ATL-HPA049892)