Anti STAT5A pAb (ATL-HPA049883)

Atlas Antibodies

Catalog No.: ATL-HPA049883-25

Protein Description: signal transducer and activator of transcription 5A
Gene Name: STAT5A
Alternative Gene Name: MGF, STAT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020919: 100%, ENSRNOG00000019496: 100%
Entrez Gene ID: 6776
Uniprot ID: P42229
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KTQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRN
• Gene Sequence: KTQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRN
• Gene ID - Mouse: ENSMUSG00000020919
• Gene ID - Rat: ENSRNOG00000019496
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.