Anti STAT5A pAb (ATL-HPA042128)

Atlas Antibodies

Catalog No.:
ATL-HPA042128-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: signal transducer and activator of transcription 5A
Gene Name: STAT5A
Alternative Gene Name: MGF, STAT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020919: 100%, ENSRNOG00000019496: 100%
Entrez Gene ID: 6776
Uniprot ID: P42229
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVL
Gene Sequence EGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVL
Gene ID - Mouse ENSMUSG00000020919
Gene ID - Rat ENSRNOG00000019496
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STAT5A pAb (ATL-HPA042128)
Datasheet Anti STAT5A pAb (ATL-HPA042128) Datasheet (External Link)
Vendor Page Anti STAT5A pAb (ATL-HPA042128) at Atlas Antibodies

Documents & Links for Anti STAT5A pAb (ATL-HPA042128)
Datasheet Anti STAT5A pAb (ATL-HPA042128) Datasheet (External Link)
Vendor Page Anti STAT5A pAb (ATL-HPA042128)