Anti STAT3 pAb (ATL-HPA058603 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA058603-100
  • Immunohistochemical staining of human spleen shows moderate cytoplasmic positivity in cells in red pulp.
  • Western blot analysis in human cell lines A-549 and PC-3 using Anti-STAT3 antibody. Corresponding STAT3 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Shipping:
Calculated at Checkout
$486.00
Adding to cart… The item has been added
Protein Description: signal transducer and activator of transcription 3 (acute-phase response factor)
Gene Name: STAT3
Alternative Gene Name: APRF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004040: 100%, ENSRNOG00000019742: 100%
Entrez Gene ID: 6774
Uniprot ID: P40763
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQK
Gene Sequence EKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQK
Gene ID - Mouse ENSMUSG00000004040
Gene ID - Rat ENSRNOG00000019742
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti STAT3 pAb (ATL-HPA058603 w/enhanced validation)
Datasheet Anti STAT3 pAb (ATL-HPA058603 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti STAT3 pAb (ATL-HPA058603 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti STAT3 pAb (ATL-HPA058603 w/enhanced validation)
Datasheet Anti STAT3 pAb (ATL-HPA058603 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti STAT3 pAb (ATL-HPA058603 w/enhanced validation)



Citations for Anti STAT3 pAb (ATL-HPA058603 w/enhanced validation) – 1 Found
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed