Anti STARD8 pAb (ATL-HPA060788)

Atlas Antibodies

SKU: ATL-HPA060788-25

• 

Protein Description: StAR-related lipid transfer (START) domain containing 8
Gene Name: STARD8
Alternative Gene Name: ARHGAP38, KIAA0189
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031216: 80%, ENSRNOG00000033883: 73%
Entrez Gene ID: 9754
Uniprot ID: Q92502
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PAQDSEQEAHSGGEPTFASSLSVEEGHSISDTVASSSELDSSGNSMNEAEAAGPLAGLQASMPRERRDSGV
• Gene Sequence: PAQDSEQEAHSGGEPTFASSLSVEEGHSISDTVASSSELDSSGNSMNEAEAAGPLAGLQASMPRERRDSGV
• Gene ID - Mouse: ENSMUSG00000031216
• Gene ID - Rat: ENSRNOG00000033883
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.