Anti STAMBP pAb (ATL-HPA035801)

Atlas Antibodies

Catalog No.:
ATL-HPA035801-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: STAM binding protein
Gene Name: STAMBP
Alternative Gene Name: AMSH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006906: 77%, ENSRNOG00000012227: 78%
Entrez Gene ID: 10617
Uniprot ID: O95630
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCG
Gene Sequence DCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCG
Gene ID - Mouse ENSMUSG00000006906
Gene ID - Rat ENSRNOG00000012227
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STAMBP pAb (ATL-HPA035801)
Datasheet Anti STAMBP pAb (ATL-HPA035801) Datasheet (External Link)
Vendor Page Anti STAMBP pAb (ATL-HPA035801) at Atlas Antibodies

Documents & Links for Anti STAMBP pAb (ATL-HPA035801)
Datasheet Anti STAMBP pAb (ATL-HPA035801) Datasheet (External Link)
Vendor Page Anti STAMBP pAb (ATL-HPA035801)