Anti STAM pAb (ATL-HPA043882)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043882-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: STAM
Alternative Gene Name: STAM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026718: 98%, ENSRNOG00000060817: 98%
Entrez Gene ID: 8027
Uniprot ID: Q92783
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANK |
| Gene Sequence | LMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANK |
| Gene ID - Mouse | ENSMUSG00000026718 |
| Gene ID - Rat | ENSRNOG00000060817 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti STAM pAb (ATL-HPA043882) | |
| Datasheet | Anti STAM pAb (ATL-HPA043882) Datasheet (External Link) |
| Vendor Page | Anti STAM pAb (ATL-HPA043882) at Atlas Antibodies |
| Documents & Links for Anti STAM pAb (ATL-HPA043882) | |
| Datasheet | Anti STAM pAb (ATL-HPA043882) Datasheet (External Link) |
| Vendor Page | Anti STAM pAb (ATL-HPA043882) |