Anti STAM pAb (ATL-HPA043882)

Atlas Antibodies

Catalog No.:
ATL-HPA043882-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: signal transducing adaptor molecule (SH3 domain and ITAM motif) 1
Gene Name: STAM
Alternative Gene Name: STAM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026718: 98%, ENSRNOG00000060817: 98%
Entrez Gene ID: 8027
Uniprot ID: Q92783
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANK
Gene Sequence LMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANK
Gene ID - Mouse ENSMUSG00000026718
Gene ID - Rat ENSRNOG00000060817
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STAM pAb (ATL-HPA043882)
Datasheet Anti STAM pAb (ATL-HPA043882) Datasheet (External Link)
Vendor Page Anti STAM pAb (ATL-HPA043882) at Atlas Antibodies

Documents & Links for Anti STAM pAb (ATL-HPA043882)
Datasheet Anti STAM pAb (ATL-HPA043882) Datasheet (External Link)
Vendor Page Anti STAM pAb (ATL-HPA043882)