Anti STAG2 pAb (ATL-HPA002857)

Atlas Antibodies

Catalog No.: ATL-HPA002857-25

Protein Description: stromal antigen 2
Gene Name: STAG2
Alternative Gene Name: SA-2, SCC3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025862: 99%, ENSRNOG00000029885: 99%
Entrez Gene ID: 10735
Uniprot ID: Q8N3U4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTAKEKKTQLDDRTKITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLDALLRQIRNIVEKHTDTDVLEACSKTYHALCNEEFTIFNRVDISRSQLIDELADKFNRLLEDFLQEGE
• Gene Sequence: LTAKEKKTQLDDRTKITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLDALLRQIRNIVEKHTDTDVLEACSKTYHALCNEEFTIFNRVDISRSQLIDELADKFNRLLEDFLQEGE
• Gene ID - Mouse: ENSMUSG00000025862
• Gene ID - Rat: ENSRNOG00000029885
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti STAG2 pAb (ATL-HPA002857) – 3 Found

Liu, Yunhua; Xu, Hanchen; Van der Jeught, Kevin; Li, Yujing; Liu, Sheng; Zhang, Lu; Fang, Yuanzhang; Zhang, Xinna; Radovich, Milan; Schneider, Bryan P; He, Xiaoming; Huang, Cheng; Zhang, Chi; Wan, Jun; Ji, Guang; Lu, Xiongbin. Somatic mutation of the cohesin complex subunit confers therapeutic vulnerabilities in cancer. The Journal Of Clinical Investigation. 2018;128(7):2951-2965. 

Nicholson, Anna M; Olpe, Cora; Hoyle, Alice; Thorsen, Ann-Sofie; Rus, Teja; Colombé, Mathilde; Brunton-Sim, Roxanne; Kemp, Richard; Marks, Kate; Quirke, Phil; Malhotra, Shalini; Ten Hoopen, Rogier; Ibrahim, Ashraf; Lindskog, Cecilia; Myers, Meagan B; Parsons, Barbara; Tavaré, Simon; Wilkinson, Mark; Morrissey, Edward; Winton, Douglas J. Fixation and Spread of Somatic Mutations in Adult Human Colonic Epithelium. Cell Stem Cell. 2018;22(6):909-918.e8. 

Gan, Wenqiang; Wang, Weiqi; Li, Tiegang; Zhang, Rixin; Hou, Yufang; Lv, Silin; Zeng, Zifan; Yan, Zheng; Yang, Min. Prognostic Values and Underlying Regulatory Network of Cohesin Subunits in Esophageal Carcinoma. Journal Of Cancer. 13(5):1588-1602.