Anti STAC3 pAb (ATL-HPA039285)

Atlas Antibodies

Catalog No.: ATL-HPA039285-25

Protein Description: SH3 and cysteine rich domain 3
Gene Name: STAC3
Alternative Gene Name: MGC2793
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040287: 91%, ENSRNOG00000008050: 95%
Entrez Gene ID: 246329
Uniprot ID: Q96MF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VCARMIVLNNKFGLRCKNCKTNIHEHCQSYVEMQRCFGKIPPGFHRAYSSPLYSNQQYACVKDLSAANRNDPVFET
• Gene Sequence: VCARMIVLNNKFGLRCKNCKTNIHEHCQSYVEMQRCFGKIPPGFHRAYSSPLYSNQQYACVKDLSAANRNDPVFET
• Gene ID - Mouse: ENSMUSG00000040287
• Gene ID - Rat: ENSRNOG00000008050
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.