Anti STAC2 pAb (ATL-HPA076925)

Atlas Antibodies

Catalog No.:
ATL-HPA076925-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: SH3 and cysteine rich domain 2
Gene Name: STAC2
Alternative Gene Name: 24b2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017400: 97%, ENSRNOG00000004805: 99%
Entrez Gene ID: 342667
Uniprot ID: Q6ZMT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KPVRLHSFQEHVFKRASPCELCHQLIVGNSKQGLRCKMCKVSVHLWCSEEISHQQCPGKTSTSFRRNFSSPLLVHEP
Gene Sequence KPVRLHSFQEHVFKRASPCELCHQLIVGNSKQGLRCKMCKVSVHLWCSEEISHQQCPGKTSTSFRRNFSSPLLVHEP
Gene ID - Mouse ENSMUSG00000017400
Gene ID - Rat ENSRNOG00000004805
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti STAC2 pAb (ATL-HPA076925)
Datasheet Anti STAC2 pAb (ATL-HPA076925) Datasheet (External Link)
Vendor Page Anti STAC2 pAb (ATL-HPA076925) at Atlas Antibodies

Documents & Links for Anti STAC2 pAb (ATL-HPA076925)
Datasheet Anti STAC2 pAb (ATL-HPA076925) Datasheet (External Link)
Vendor Page Anti STAC2 pAb (ATL-HPA076925)