Anti ST8SIA4 pAb (ATL-HPA051126)

Atlas Antibodies

SKU:
ATL-HPA051126-100
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4
Gene Name: ST8SIA4
Alternative Gene Name: PST, PST1, SIAT8D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040710: 95%, ENSRNOG00000019128: 93%
Entrez Gene ID: 7903
Uniprot ID: Q92187
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLD
Gene Sequence RTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLD
Gene ID - Mouse ENSMUSG00000040710
Gene ID - Rat ENSRNOG00000019128
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ST8SIA4 pAb (ATL-HPA051126)
Datasheet Anti ST8SIA4 pAb (ATL-HPA051126) Datasheet (External Link)
Vendor Page Anti ST8SIA4 pAb (ATL-HPA051126) at Atlas Antibodies

Documents & Links for Anti ST8SIA4 pAb (ATL-HPA051126)
Datasheet Anti ST8SIA4 pAb (ATL-HPA051126) Datasheet (External Link)
Vendor Page Anti ST8SIA4 pAb (ATL-HPA051126)