Anti ST8SIA3 pAb (ATL-HPA066783)

Atlas Antibodies

Catalog No.:
ATL-HPA066783-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 3
Gene Name: ST8SIA3
Alternative Gene Name: SIAT8C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056812: 100%, ENSRNOG00000018305: 100%
Entrez Gene ID: 51046
Uniprot ID: O43173
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WPFGFDPNTREDLPYHYYDKKGTKFTTKWQESHQLPAEFQLLYRMHGEGLTKLTLSHCA
Gene Sequence WPFGFDPNTREDLPYHYYDKKGTKFTTKWQESHQLPAEFQLLYRMHGEGLTKLTLSHCA
Gene ID - Mouse ENSMUSG00000056812
Gene ID - Rat ENSRNOG00000018305
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ST8SIA3 pAb (ATL-HPA066783)
Datasheet Anti ST8SIA3 pAb (ATL-HPA066783) Datasheet (External Link)
Vendor Page Anti ST8SIA3 pAb (ATL-HPA066783) at Atlas Antibodies

Documents & Links for Anti ST8SIA3 pAb (ATL-HPA066783)
Datasheet Anti ST8SIA3 pAb (ATL-HPA066783) Datasheet (External Link)
Vendor Page Anti ST8SIA3 pAb (ATL-HPA066783)