Anti ST8SIA2 pAb (ATL-HPA057819)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057819-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ST8SIA2
Alternative Gene Name: HsT19690, SIAT8B, ST8SIA-II, STX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025789: 96%, ENSRNOG00000022791: 28%
Entrez Gene ID: 8128
Uniprot ID: Q92186
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQI |
| Gene Sequence | EEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQI |
| Gene ID - Mouse | ENSMUSG00000025789 |
| Gene ID - Rat | ENSRNOG00000022791 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ST8SIA2 pAb (ATL-HPA057819) | |
| Datasheet | Anti ST8SIA2 pAb (ATL-HPA057819) Datasheet (External Link) |
| Vendor Page | Anti ST8SIA2 pAb (ATL-HPA057819) at Atlas Antibodies |
| Documents & Links for Anti ST8SIA2 pAb (ATL-HPA057819) | |
| Datasheet | Anti ST8SIA2 pAb (ATL-HPA057819) Datasheet (External Link) |
| Vendor Page | Anti ST8SIA2 pAb (ATL-HPA057819) |