Anti ST8SIA2 pAb (ATL-HPA057819)

Atlas Antibodies

Catalog No.:
ATL-HPA057819-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2
Gene Name: ST8SIA2
Alternative Gene Name: HsT19690, SIAT8B, ST8SIA-II, STX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025789: 96%, ENSRNOG00000022791: 28%
Entrez Gene ID: 8128
Uniprot ID: Q92186
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQI
Gene Sequence EEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQI
Gene ID - Mouse ENSMUSG00000025789
Gene ID - Rat ENSRNOG00000022791
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ST8SIA2 pAb (ATL-HPA057819)
Datasheet Anti ST8SIA2 pAb (ATL-HPA057819) Datasheet (External Link)
Vendor Page Anti ST8SIA2 pAb (ATL-HPA057819) at Atlas Antibodies

Documents & Links for Anti ST8SIA2 pAb (ATL-HPA057819)
Datasheet Anti ST8SIA2 pAb (ATL-HPA057819) Datasheet (External Link)
Vendor Page Anti ST8SIA2 pAb (ATL-HPA057819)